PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.TC0KD
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 380aa    MW: 42175.4 Da    PI: 6.6254
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.TC0KDgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-17201255256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Aradu.TC0KD 201 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 255
                  778899***********************************************98 PP

2HD-ZIP_I/II127.36.8e-41201291192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een++L+ke +eLr +lk
  Aradu.TC0KD 201 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRKLHKELQELR-ALK 291
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-18174258IPR009057Homeodomain-like
SuperFamilySSF466891.03E-18188258IPR009057Homeodomain-like
PROSITE profilePS5007117.086197257IPR001356Homeobox domain
SMARTSM003894.9E-16199261IPR001356Homeobox domain
CDDcd000863.95E-15201258No hitNo description
PfamPF000464.5E-15201255IPR001356Homeobox domain
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
SMARTSM003403.8E-25257300IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-10257291IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MELGLSLGDS SRPFVGFMEK PRSEPSSNQL GLGFTTTTLS IGPIITTKRQ RDQQEQQLQQ  60
QEHEDKEEAK PKDDNPHLHQ LDFLPQLSLP WHPSENGRVS KGLDVNVLPL TTVAATAAAG  120
ADDEVEEGEA LSSSPNSAAS SFQTDLCIFG GGGSYSGGSG GNYYNYGGKR DHSDGEGYDH  180
QRDCSRASDE DENCGRGGGT RKKLRLSKEQ SAYLEESFKE HNTLNPKQKL ALAKQLNLRP  240
RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ETLTEENRKL HKELQELRAL KTSNPFYMQL  300
PATTLTMCPS CERVATNPSS NNSPSPTPPS NNNSNNNNII NSNNDSNSKV IGFPLGKHTF  360
HPFAHTTQPQ QHHPHQSTES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199205TRKKLRL
2249257RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015932528.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotQ6YPD02e-88HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLV7BVK41e-142V7BVK4_PHAVU; Uncharacterized protein
STRINGGLYMA15G42380.11e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-55homeobox from Arabidopsis thaliana